PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113973001
Common NameGSBRNA2T00113973001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 625aa    MW: 70628.9 Da    PI: 6.8775
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113973001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1001.6e-31113166255
              G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  GSBRNA2T00113973001 113 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 166
                          9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.09E-15110166IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-28111166IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-23113166IPR006447Myb domain, plants
PfamPF002491.3E-6114165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 625 aa     Download sequence    Send to blast
MIMFESRSSV RGSNSVPDLS LQISLPNSHA EKPLHGSERS FTTSSDSGSS LSELSHENSF  60
LKKHLLSLGF DHHHPYHHHQ RHSSNMFQPQ IYGRDFKRTS SSVVSLKRSI RAPRMRWTST  120
LHAHFVHAVQ LLGGHERATP KSVLELMNVK DLTLAHVKSH LQMYRTVKCT DKRSSGERKV  180
EKEAEQKTED NNNNNEDADA DPISPNSSSV QKTQRSPWSS TKGVSMSISQ ADPHMEIYRI  240
TKDDVEKDHL SLEFTLGRPS WGIDHVGELR RWDQGRLIDP TRRTDELDGI AQSNSPNGRV  300
GRLARSNSPN GRVGRCILAS WTMGVFAVWD PLSEALCNLP RRLKEGEESS MDGFIQHKAP  360
TERRGSRTRK EKHIAVDDDA SYREGFTEDI LGEYLNCGVP IDLDELLGSD VPASEDGSGK  420
GPKFTKASRM VNGGLLMMNQ ALDASSQEAR MAQFRAEMAD KKIALLRDEL ERSCRCEGEL  480
TAKEIHRAYR RGKKEMDEVM KNRRAQFSYE FGEFKESYQA LGAYRECCST VGGLYLMQAP  540
DYSFAAENVT QIRHMKERYR DFALPQIEER IWKQWEPIPV SRDTVEAETR APDETGEVNQ  600
PSVPLNVNDY SVGGSMTEYY EFDG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113973001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A078EMJ50.0A0A078EMJ5_BRANA; BnaA02g23100D protein
STRINGBra035311.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-105G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]